COPE Media Kit


Cope Home
Previous entry:
Drosokinin
Next entry:
drosomycin-1
Random entry:
tumor necrosis factor alpha-inducing factor alpha
Search COPE:

drosomycin

Drosomycin, encoded by gene CG10810, is an inducible antibacterial peptide isolated from Drosophila melanogaster. The peptide (44 amino acids; DCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC) (Levy et al, 2004) contains 8 cysteines engaged in intramolecular disulfide bridges. Drosomycin shows a significant homology with a family of 5 kDa cysteine-rich plant antifungal defensins from seeds of Brassicaceae (Fehlbaum et al, 1994). Drosomycin also shares the same array of intramolecular disulfide bridges with plant defensins (Michaut et al, 1996).

Drosomycin is produced primarily in the fat body and hemocytes during a systemic immune response and has potent antifungal activity but is inactive against bacteria. Activation of this systemic response requires ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: August 2013



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=15686