Defensin-beta-2 |
Defensin-beta-4 |
ARFs |
||
[beta-Defensin-3]. Defensin-beta-3 (sequence: GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK) is a member of the family of Beta-Defensins. The approved gene symbol is DEFB103A [defensin-beta 103A; beta-Defensin 103A; previously: DEFB103, DEFB3] (Boniotto et al, 2003). The human gene has been cloned by Jia et al (2001) who referred to it as HBD-3 and reported induction of defensin-beta-3 in fetal lung tissue by IL1-beta. Harder et al (2001) independently cloned defensin-beta-3, showed expression in primary keratinocytes and epithelial cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |