defensin-beta-109 |
defensin-beta-119 |
MLKAHLIFSTPLTISLFDCATWRPYLQTEYYDVMTVISPPEFG |
||
[Beta-defensin 118] approved gene symbol: DEFB118. The cDNA for this protein has been cloned by Liu et al (2001) as ESC42 [Epididymis-specific clone 42] from a rhesus monkey epididymis cDNA library. They also identified human ESC42, showing that monkey and human ESC42 proteins contain 123 amino acids and share 94 % amino acid identity. In databanks the protein is known also as ESP13.6 [Epididymal secretory protein 13.6]. The human gene is encoded by C20orf63
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |