bushy neurons |
Buthus martensii Karsch analgesic-antitumor peptide |
neocytolysis |
||
A peptide of 34 amino acids (SIVPIRCRSNRDCRRFCGFRGGRCTYARQCLCGY) containing three disulfide bridges. The peptide has been isolated from the hemolymph of unchallenged scorpions of the species Androctonus australis. Buthinin is active against Gram-positive bacteria and Gram-negative) bacteria.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |