COPE Media Kit

Cope Home
Previous entry:
buforin IIb
Next entry:
bullfrog pepsinogen A-derived antimicrobial peptide
Random entry:
clock cells
Search COPE:


Buforin-1 (AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY) has been isolated from the stomach tissue of the Asian toad Bufo bufo gargarizans (for review see: Cho et al, 2009). Its amino acid sequence is identical in 37 of 39 amino-terminal residues with Xenopus laevis histone H2A (Park et al, 1996) (for bioactive fragments of histone proteins see also: HDAPs [Histone-derived antimicrobial peptides]).

Buforin-1 shows strong antimicrobial activities in vitro against a broad-spectrum of microorganisms and is more potent than magainin-2 (Giacometti et al, 1999, 2000; Park et al, 1996).

Buforin-2 ... ... ... ... ... Subscribe to continue reading! ... ...


Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at

See example pages at the bottom of the home page
The others just sisyphos around


Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia


SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions

U L T R A   P O S S E    N E M O   O B L I G A T U R

cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=6796