bluetongue virus nonstructural protein 3 |
B-lymphoblast antigen-1 |
QAFKTFTPDWNKIRNDAKRMQDNLEQMKKRFNLNL |
||
[bluetongue virus nonstructural protein 3; BTV NS3 protein] This protein is encoded in the genome of bluetongue virus, a member of the Orbivirus genus within the Reoviridae family of segmented double-stranded RNA viruses. The protein has been shown previously to be important for efficient release of newly made virions from infected cells (Beaton et al, 2002). Han and Harty (2004) have reported that the protein has channel-forming activity and acts like a viroporin. Targeting of NS3 protein to the Golgi apparatus and plasma membrane correlates with the enhanced permeability of cells to the translation inhibitor hygromycin B.
For other relevant entries see also the Pathogenicity/Virulence Factors Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |