Angio-associated migratory protein |
Angiocidin |
TVDFGLARGYSGTQEAKHRMGLAAANFAGGP |
||
[angioblast, angioblastic]
These cells are progenitors of endothelial cells found in bone marrow (for nomenclature see also: Medina et al, 2017). They develop from hemangioblasts. Unlike bipotential hemangioblasts, which have the capacity to develop into blood cells and endothelial cells, angioblasts are committed to endothelial lineage differentiation (Schatteman and Awad, 2004; Schatteman, 2004). In older references these cells may be referred to as vasofactive cells or vasoformative cells, reflecting their role in angiogenesis.
These cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |