abaecin

abaecin (34 amino acids; YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY) is a major antibacterial response peptide in the honeybee (Apis mellifera) (Casteels et al, 1990). Abaecin has a broad spectrum of antibacterial activities, specific activities against Gram-negative plant pathogens that are lowers than those of other bee peptides (apidaecins), and is incapable of inhibiting bacterial growth at medium ionic strengths. The highest observed specific activity is against an apidaecin-resistant Xanthomonas strain. Expression of the peptide is induced after challenge of honey bees with the natural pathogen Paenibacillus larvae larvae (Evans and Lopez, 2004).

A 39 residue abaecin (FVPYNPPRPGQSKPFPSFPGHGPFNPKIQWPYPLPNPGH ... ... ... ...
 
... CONTINUE READING at cells-talk.com, COPE's new home with 61 100+ entries, 141 552 cited references and >2,5 million internal hyperlinks. This most comprehensive knowledge base provides extensive in-context information covering nomenclature, terminology, and highlighting concepts, strategies & complexities of cellular communication processes. COPE's fully integrated subdictionaries include Dictionary of Angiogenesis • Dictionary of Antimicrobial & host defense peptides • Dictionary of Apoptosis and cell death • Dictionary of CD antigens • Dictionary of Chemokines • Dictionary of Cryptides • Dictionary of Cytokines & Growth factors • Dictionary of Eukaryotic cell types & expression profiles • Dictionary of Hematopoiesis • Dictionary of Hormones • Dictionary of Inflamation & inflammatory mediators • Dictionary of Innate Immunity • Dictionary of Metalloproteinases • Dictionary of Moonlighting proteins & cryptides • Dictionary of Neuropeptides • Dictionary of Pathogenicity & Virulence Factors • Dictionary of Pattern recognition receptors • Dictionary of Protein domains • Dictionary of Regulatory peptide factors • Dictionary of Viroceptors • Dictionary of Virokines • Dictionary of Stem cells and more.
 
An important note about your privacy: A search engine may have brought you here. If the provided URL differs in any way from "www.copewithcytokines.org/cope.cgi?key=search term", 3rd parties may record your activities on COPE. Bypass snoopers by doing this: Go directly to cells-talk.com or go to copewithcytokines.org in a new browser tab and from there explore whether COPE contains the terms that interest you. The private bioinformatics initiative COPE at cells-talk.com never shares your search histories or user databank entry with 3rd parties.

Copyright © 1997-2025. All rights reserved by Dr H Ibelgaufts, the sole author/owner/maintainer of the COPE Knowledge Base. EXPLICITLY: COPE's contents are strictly for the personal use of subscribers. They aren't in the public-domain and may not be reproduced elsewhere or transmitted in any form!

Entry last modified: November 2012