VSCNGVCSPFEMPPCGSSACRCIPYGLVVGNCRHPSG |
VSEL-SC |
Interleukin-1 family member 3 |
||
[vessel dilator] VSDL is a biologically active peptide fragment derived from the ANF precursor and corresponds to ANP(31-67). See: ANF [Atrial natriuretic factor; atrionatriuretic factor].
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also:
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted !
COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base