THi |
thickveins |
Gm6484 |
||
[Thionin 2.1] This antimicrobial peptide (KICCPSNQARNGYSVCRIRFSKGRCMQVSGCQNSDTCPRGWVN) has been identified in Arabidopsis thaliana (Epple et al, 1995). The expression of this defense peptide in plants is induced by various stimuli, including wounding and pathogens (Bohlmann et al, 1998; Vignutelli et al, 1998), and overexpression enhances resistance against phytopathogens (Epple et al, 1997).
Thi2.1 is active against Escherichia coli, Staphylococcus aureus, Candida albicans when overexpressed in mammalian endothelial cells. It also inhibits the viability of several transformed and normal mammal cell lines (Loeza-Angeles et al, 2008).
For other proteins/peptides with functions in innate immunity
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |