TBP-1 |
TBP-2 |
WKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTA |
||
[TNF binding protein-1] This protein is identical with the alpha (55 kDa) subunit of the TNF-alpha receptor (see: TNF-alpha). In the nomenclature of CD antigens this protein has been given the designation CD120a.
For additional information on CD antigens see also: CD antigens Dictionary.
See remarks in the CD antigens Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |