COPE Media Kit


Cope Home
Previous entry:
NK-RIF
Next entry:
NKR lymphoid tissue inducer cells
Random entry:
GFGSLFKFLAKKVAKTVAKQAAKQGAKYVANKHME
Search COPE:

NKR-LTi cells

[NKR lymphoid tissue inducer cells] This cell type, found in mucosal tissues, has been described by Vonarbourg et al (2010) and is considered a subpopulation of innate lymphoid cells (group 3 innate lymphoid cells).

There are two subpopulations that are distinguished by the expression of transcription factor ROR-gammat-t. IL7 and intestinal microbiota stabilize ROR-gammat-t expression within such cells. IL12 and IL15 accelerate ROR-gammat-t loss.

NKR-LTi cells that express ROR-gammat-t also produce IL-22. NKR-LTi cells that do not express ROR-gammat-t release IFN-gamma and are potent inducers of inflammatory ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: February 2014



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=36748