Mo2 |
MO3e |
APPGRSDVYPPPLGSEHNGQVAEDAVSRPKDDSVPEVRAA |
||
[Monocyte activation antigen MO3] MO3 (also: MO3e [Monocyte activation antigen MO3e] in older publications) is a protease-sensitive highly glycosylated glycoprotein anchored to the plasma membrane by a GPI linkage (Mizukami et al, 1990). The protein is expressed on the plasma membrane of human monocytes and myelomonocytic cell lines after exposure in vitro to LPS, muramyl dipeptide, phorbol 12-myristate 13-acetate (see: Phorbol esters), and selected cytokines such as GM-CSF, M-CSF, and TNF-alpha) (Todd et al, 1985, 1986, 1987,1990,).
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |