MIAP |
MIA SH3 domain containing |
MPCSCKKYCDPWEVIDGSCGLFNSKYICCREK |
||
[mouse inhibitor of apoptosis protein-3] This protein (496 amino acids) is the murine homolog (MIAP) of XIAP (94 % identity), a protein that inhibits cell death by apoptosis (Farahani et al, 1997).
For other entries pertaining to cell death mechanisms see also the Apoptosis and Cell Death Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |