MAIPPKKNQDK |
MAIR-I |
CTTGPCCRQCKLKPAGTTCWKTSRTSHYCTGKSCDCPVYQG |
||
[Macrophage-derived Apoptosis-Inducing RBCC protein] This RING-B-Box-coiled-coil (RBCC) protein consists of an N-terminal RING finger, followed by a B-Box zinc finger, a coiled-coil domain and a B30.2 domain. MAIR mRNA is expressed widely in mouse tissues. Its expression is induced by M-CSF in murine peritoneal and bone marrow macrophages. Ectopic expression of MAIR causes activation of caspase-7, caspase-8 and caspase-9 but not caspase-3, followed by apoptosis.
The cDNA has been cloned as
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |