LINGO1 |
linguistic imperialism |
LERK1 |
||
abbr. LAP (a term with multiple meanings). This antimicrobial peptide (GFTQGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK) has been isolated from bovine tongue tissues. The peptide is a member of the family of Beta-Defensins and shows a broad spectrum of antibacterial and antifungal activities. Its expression is increased markedly in the epithelium surrounding naturally occurring tongue lesions associated with acute and chronic inflammation in the underlying lamina propria (Schonwetter et al, 1995). LAP is expressed coordinately with another antimicrobial peptide, tracheal antimicrobial peptide (TAP), by tracheal epithelial cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |