L60 |
L129 |
GWKDWLKKGKEWLKAKGPGIVKAALQAATQ |
||
The monoclonal antibody of this name recognizes a protein known as gp130 antigen (not to be confused with the signal transducer gp130) (Schön et al, 2005). In the nomenclature of CD antigens this protein has been given the designation CD146.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |