KFRKTCAPMGYCSPKCRVMDLKYTSGDCKYSCCIPTAWKGK |
KG1a |
interferon-induced protein 16-alpha |
||
A human acute myeloid leukemia cell line established from a patient with acute myelogenous leukemia that had evolved from an erythroleukemia. It represents an early stage of hematopoietic differentiation (see also: hematopoiesis).
A subline of KG-1, designated KG1a, has lost myeloid features, acquired new karyotypic markers, and has several characteristics associated with immature T-cells. The cells are deficient in human p53. Both KG-1 and KG1a transcribe unrearranged IgH genes. Shmelkov et al (2001) have used a two-dimensional Gene Expression Fingerprinting to compare the gene expression
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |