COPE Media Kit


Cope Home
Previous entry:
GSLMDILRNHEMDNINLGKNANNGGEFARGFNEEEIF
Next entry:
GSNKGAIIGLM
Random entry:
RSLQDTEEKSRSFSASQADPLSDPDQMNED
Search COPE:

GSM

[Glucocorticoid-suppressible mitogenic activity] This factor is found in the conditioned medium of a rat hepatoma cell line (subline BDS.1 of the Fu5 hepatoma cell line) which are hypersensitive to the antiproliferative effects of the glucocorticoid dexamethasone (Cook et al, 1989).

The GSM activity is secreted constitutively into the conditioned medium of EDR3 cells, a subline of Fu5 which is resistant to the antiproliferative effects of dexamethasone. GSM expression is suppressed by treatment of the cells with glucocorticoids.

GSM stimulates incorporation of tritiated thymidine in quiescent, serum-starved Balb/c 3T3 cells. GSM stimulates 3T3 cells ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: January 2002



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=22548