GRPRESGKKRKRKRLKP |
GRRKRKWLRRIGKGVKIIGGAALDHLamide |
Crustins |
||
The cDNA encoding this antimicrobial peptide (EASPRVSRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG) has been identified in hemocytes of the mud crab, Scylla paramamosain (Imjongjirak C et al, 2011). The peptide has been called Arasin-like protein as its sequence is related to Arasin 1. Expression in hemocytes is upregulated in response to change with Aerococcus viridans. A synthetic GRPSp peptide has antibacterial activity against some Gram-positive (A. viridans and Micrococcus luteus), but not Gram-negative, bacteria.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also:
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |