GMYGGWamide |
GN |
TAMRAVDKLLLHLKKLFREGQFNRNFESIIICRDRT |
||
For this Caenorhabditis elegans peptide see: nlp-29 [Neuropeptide-like protein 29], nlp-31 [Neuropeptide-like protein 31]
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |