Fa-AMP1 |
Fabatin-1 |
CC chemokine ligand 20 |
||
[Fagopyrum antimicrobial peptide-2] This cysteine- and glycine-rich peptide (AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCR) has been purified from the seeds of buckwheat (Fagopyrum esculentum Moench.) (Fujimura et al, 2003). The peptide, which differs from Fa-AMP1 only in the terminal amino acid, belongs to the class of plant defensins and is active against plant pathogenic fungi, and Gram-positive bacteria and Gram-negative bacteria.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |