FDFGFAGLDTYDAIHRALEQPARGTSNSGSGYNMLMKMQRH |
FDGI |
kaliuretic peptide |
||
[Fibroblast-derived growth factor] This factor is found in the conditioned medium of an SV40-transformed BHK (baby hamster kidney) cell line. It is a mitogen and a chemoattractant for endothelial cells (see also: Chemotaxis). This factor belongs to the group of PDGF-like growth factors and is very like identical with one of the molecular forms of PDGF.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |