FAT |
fat-associated lymphoid cluster |
MAHQRKSLVIFIFLTVLVFVFALPRDATVFDNQHSEVAIEKSTSKIDSS |
||
Another designation is Diubiquitin. The cDNA for this human gene (approved gene symbol UBD for ubiquitin D) has been cloned by Bates et al (1997). The gene is expressed in B-cells and dendritic cells.
The gene is located within the human MHC class 1 gene cluster. FAT10 encodes a protein consisting of two domains with homology to ubiquitin. The mRNA is expressed constitutively in some lymphoblastoid lines and dendritic cells. In some cells FAT10 expression is induced by IFN-gamma or TNF-alpha. FAT10 has been shown to associate with MAD2, a protein implicated in a
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |