FPDTVACRTQGNFCRAGACPPTFTISGQCHGGLLNCCAKIPAQ |
FPF |
MRP-2 |
||
see: gp120
For other relevant entries see also the Pathogenicity/Virulence Factors Dictionary section of this encyclopedia.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |