EWI-2 without its N-terminus |
EWI-F |
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR |
||
[EWI motif-containing protein 101] The protein is a member of the immunoglobulin superfamily and contains a Glu-Trp-Ile (EWI) motif not seen in other immunoglobulin proteins (Stipps et al, 2001). In the nomenclature of CD antigens this protein has been given the designation CD101.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |