MSILPCKNVSIWVIKDTAASDKEVVLGSDRAIKFLYLATG |
MSK8 |
leukocyte immunoglobulin-like receptor subfamily B member 6 |
||
see: CRISPP [cancer recognition, immune defense suppression, and serine protease protection peptide]
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |