air8 |
airway smooth muscle cells |
GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
||
[adhesion inhibitory receptor molecule 1] This inhibitory receptor (467 amino acids, 75 kDa, called also p75/AIRM1) is a member of the sialoadhesin family that appears to mediate ligand recognition dependent on sialic acid and has been identified by Falco et al (1999). Expression is seen mostly on NK-cells. The factor has been given the designation SIGLEC-7 [sialic acid binding immunoglobulin-like lectin 7].
In the nomenclature of CD antigens the protein has received the designation CD328.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |