COPE Media Kit


Cope Home
Previous entry:
AIM
Next entry:
AIM2
Random entry:
SWLSKTYKKLENSAKKRISEGIAIAIQGGPR
Search COPE:

AIM1

[Absent in melanoma 1 protein] In databanks this protein is known also as CRYBG1 [Beta/gamma crystallin domain-containing protein 1] or ST4 [Suppression of Tumorigenicity 4]. AIM1 has been identified by Ray et al (1996) owing to its altered expression in association with tumor suppression in a human melanoma model. It may act as a tumor suppressor in melanoma cells (Ray et al, 1997), but its role as a tumor suppressor is not clear.

AIM1 methylation has been associated with nasopharyngeal carcinoma and primary tumor invasion of bladder cancer (Brait et al, 2008; Loyo et al, 2011). AIM1 promoter hypermethylation ... ... ... ...
 
... CONTINUE READING at cells-talk.com, COPE's new home with 61 100+ entries, 141 552 cited references and >2,5 million internal hyperlinks. This most comprehensive knowledge base provides extensive in-context information covering nomenclature, terminology, and highlighting concepts, strategies & complexities of cellular communication processes. COPE's fully integrated subdictionaries include Dictionary of Angiogenesis Dictionary of Antimicrobial & host defense peptides Dictionary of Apoptosis and cell death Dictionary of CD antigens Dictionary of Chemokines Dictionary of Cryptides Dictionary of Cytokines & Growth factors Dictionary of Eukaryotic cell types & expression profiles Dictionary of Hematopoiesis Dictionary of Hormones Dictionary of Inflamation & inflammatory mediators Dictionary of Innate Immunity Dictionary of Metalloproteinases Dictionary of Moonlighting proteins & cryptides Dictionary of Neuropeptides Dictionary of Pathogenicity & Virulence Factors Dictionary of Pattern recognition receptors Dictionary of Protein domains Dictionary of Regulatory peptide factors Dictionary of Viroceptors Dictionary of Virokines Dictionary of Stem cells and more.
 
An important note about your privacy: A search engine may have brought you here. If the provided URL differs in any way from "www.copewithcytokines.org/cope.cgi?key=search term", 3rd parties may record your activities on COPE. Bypass snoopers by doing this: Go directly to cells-talk.com or go to copewithcytokines.org in a new browser tab and from there explore whether COPE contains the terms that interest you. The private bioinformatics initiative COPE at cells-talk.com never shares your search histories or user databank entry with 3rd parties.

Copyright © 1997-2025. All rights reserved by Dr H Ibelgaufts, the sole author/owner/maintainer of the COPE Knowledge Base. EXPLICITLY: COPE's contents are strictly for the personal use of subscribers. They aren't in the public-domain and may not be reproduced elsewhere or transmitted in any form!

Entry last modified: January 2017



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=2065