COPE Media Kit


Cope Home
Previous entry:
ORX
Next entry:
OSAD
Random entry:
MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE
Search COPE:

oryzatensin

Oryzatensin (GYPMYPLPR) is a bioactive peptide isolated from the tryptic digest of rice soluble protein based on ileum-contracting and anti-opioid activities in the isolated guinea pig ileum (Takahashi et al, 1994). Oryzatensin has been shown also to promote phagocytosis activity for human polymorphonuclear leukocytes and to augment the production of superoxide anion by human peripheral leukocytes. For peptides with related activities see also: exorphins.

See also cryptides for bioactive fragments of parent proteins. For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: February 2013



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=38308