ORX |
OSAD |
MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE |
||
Oryzatensin (GYPMYPLPR) is a bioactive peptide isolated from the tryptic digest of rice soluble protein based on ileum-contracting and anti-opioid activities in the isolated guinea pig ileum (Takahashi et al, 1994). Oryzatensin has been shown also to promote phagocytosis activity for human polymorphonuclear leukocytes and to augment the production of superoxide anion by human peripheral leukocytes. For peptides with related activities see also: exorphins.
See also cryptides for bioactive fragments of parent proteins. For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also:
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |