Lebestatin |
lebocin 3 |
circumsporozoite protein(76-93) |
||
This antibacterial proline-rich and O-glycosylated peptide (DLRFLYPRGKLPVPTPPPFNPKPIYIDMGNRY) has been identified by Hara and Yamakawa (1995) in the haemolymph of the silkworm, Bombyx mori, immunized with Escherichia coli. The primary structure resembles that of abaecin (41 % identity in amino acid sequence), an antibacterial peptide of the honeybee. The gene has been cloned by Chowdhury et al, 1995). Furukawa et al (1997) have shown that lebocin forms a multiple gene family in Bombyx mori. Some of these genes (lebocin 3 (DLRFLYPRGKLPVPTLPPFNPKPIYIDMGNRY), lebocin 4 (DLRFWNPREKLPLPTLPPFNPKPIYIDMGNRY) are expressed in response to challenge with bacterial
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |