Ixosin |
iyk |
Renal carcinoma antigen NY-REN-51 |
||
This antimicrobial peptide (QLKVDLWGTRSGIQPEQHSSGKSDVRRWRSRY) has been isolated from the salivary glands of the hard tick, Ixodes sinensis (Liu et al, 2008). The cDNA encodes a precursor of 89 amino acids. Purified ixosin-B shows antimicrobial activities against bacteria and fungi. The peptide synergises with Ixosin, another salivary gland peptide.
The 11-mer peptide KRLRRVWRRWRamide derived from Ixosin-B shows potent antimicrobial activity against Escherichia coli, Staphylococcus aureus, and Pseudomonas aeruginosa and very little hemolytic activity in human erythrocytes even at high doses (Lung et al, 2012).
The 11-mer peptide
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |