COPE Media Kit


Cope Home
Previous entry:
Ixosin
Next entry:
iyk
Random entry:
Val-Cys-Asn-Phe-Ala-Ser-Arg-Asn-Asp-Tyr-Ser-Tyr-Trp-Leu-Ser-Thr-Pro
Search COPE:

ixosin-B

This antimicrobial peptide (QLKVDLWGTRSGIQPEQHSSGKSDVRRWRSRY) has been isolated from the salivary glands of the hard tick, Ixodes sinensis (Liu et al, 2008). The cDNA encodes a precursor of 89 amino acids. Purified ixosin-B shows antimicrobial activities against bacteria and fungi. The peptide synergises with Ixosin, another salivary gland peptide.

The 11-mer peptide KRLRRVWRRWRamide derived from Ixosin-B shows potent antimicrobial activity against Escherichia coli, Staphylococcus aureus, and Pseudomonas aeruginosa and very little hemolytic activity in human erythrocytes even at high doses (Lung et al, 2012).

The 11-mer peptide ... ... ... ...
 
... CONTINUE READING at cells-talk.com, COPE's new home with 61 100+ entries, 141 552 cited references and >2,5 million internal hyperlinks. This most comprehensive knowledge base provides extensive in-context information covering nomenclature, terminology, and highlighting concepts, strategies & complexities of cellular communication processes. COPE's fully integrated subdictionaries include Dictionary of Angiogenesis Dictionary of Antimicrobial & host defense peptides Dictionary of Apoptosis and cell death Dictionary of CD antigens Dictionary of Chemokines Dictionary of Cryptides Dictionary of Cytokines & Growth factors Dictionary of Eukaryotic cell types & expression profiles Dictionary of Hematopoiesis Dictionary of Hormones Dictionary of Inflamation & inflammatory mediators Dictionary of Innate Immunity Dictionary of Metalloproteinases Dictionary of Moonlighting proteins & cryptides Dictionary of Neuropeptides Dictionary of Pathogenicity & Virulence Factors Dictionary of Pattern recognition receptors Dictionary of Protein domains Dictionary of Regulatory peptide factors Dictionary of Viroceptors Dictionary of Virokines Dictionary of Stem cells and more.
 
An important note about your privacy: A search engine may have brought you here. If the provided URL differs in any way from "www.copewithcytokines.org/cope.cgi?key=search term", 3rd parties may record your activities on COPE. Bypass snoopers by doing this: Go directly to cells-talk.com or go to copewithcytokines.org in a new browser tab and from there explore whether COPE contains the terms that interest you. The private bioinformatics initiative COPE at cells-talk.com never shares your search histories or user databank entry with 3rd parties.

Copyright © 1997-2025. All rights reserved by Dr H Ibelgaufts, the sole author/owner/maintainer of the COPE Knowledge Base. EXPLICITLY: COPE's contents are strictly for the personal use of subscribers. They aren't in the public-domain and may not be reproduced elsewhere or transmitted in any form!

Entry last modified: November 2016



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=31241