Innate immunity Dictionary |
innate lymphoid cells |
VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL |
||
[innate-like B cell]
This collective term usually refers to two subsets of B-cells, marginal zone B-cells and B-1 cells, that differ from the vast majority of conventional B-cells (follicular B-cells) by their ability to quickly differentiate into antibody-secreting cells producing natural polyreactive antibodies in response to stimulation by ligands of Toll-like receptors (Martin and Kearney, 2000; Rubtsov et al, 2008; for overview see also: Tsay and Zouali, 2018). This is in contrast to follicular B-cells, which produce specific antibodies with much slower kinetics and require stimulation by both B-cell receptor and Toll-like receptors for differentiation into
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |