casein-kappa |
casein-kappa(18-24) |
APKWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYKG |
||
Also: kappa-casein(17-21). This bioactive peptide with the sequence FFSNK (Phe-Phe-Ser-Asn-Lys) is being referred to also as Kappa-casecidin. It is derived from bovine casein-kappa. The peptide may act as a defense peptide that shows antimicrobial activity and is active against Staphylococcus aureus, Escherichia coli, and Salmonella typhimurium (Matin and Otani, 2002).
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |