Branchiostoma japonicum ribosomal protein S23 |
branch point disrupted |
GLRKKFRKTRKRIQKLGRKIGKTGRKVWKAWREYGQIPYPCRI |
||
abbr. bnl. The Drosophila melanogaster gene bnl (gene CG4608) encodes a protein related to mammalian fibroblast growth factors (see also: FGF). branchless is a homolog of mammalian FGF (Sutherland et al, 1996).
branchless is a ligand for breathless (gene symbol: btl), an FGF receptor homolog, which encodes a receptor tyrosine kinase expressed on developing tracheal cells. Interactions between the ligand and its receptor involve the participation of sprouty.
Localized and transient expression of branchless plays a
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |