Zbtb38 |
ZC3H12A |
HPHVCTSYYCSKFCGTAGCTRYGCRNLHRGKLCFCLHCSR |
||
[Zinc finger CCCH domain-containing protein 2] See: ZAP [Zinc finger antiviral protein].
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
For other entries pertaining to cell death mechanisms see also the Apoptosis and Cell Death Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |