Xen cells |
Xenin-6 |
LAMP-3 |
||
Xenin, called also Xenin-25, is a peptide hormone (25 amino acids; MLTKFETKSARVKGLSFHPKRPWIL) (Feurle et al, 1992). The peptide is related to the frog peptide Xenopsin (Feurle et al, 1992). Xenin itself constitutes the aminoterminal end of Proxenin (MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQL) and can be generated from Proxenin by cleavage with pepsin (Hamscher et al, 1996). Xenin appears to be a cleavage product of alpha-COP [coatomer protein complex alpha subunit; alpha coatomer protein] (approved gene symbol: COPA), a gene cloned
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |