XCL1 |
XCL100 |
RWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI |
||
[chemokine C motif ligand-2] also: CL2. approved gene symbol for a member of a group of cytokines generally known as chemokines (Zlotnik and Yoshie, 2000). Members of this group of so-called C-Chemokines belong to the SCY family of cytokines and are designated XCL (L for ligand) followed by a number. An older designation is SCYC2 [small inducible cytokine subfamily C member 2].
XCL2 has been identified independently as SCM-1-beta. In some publication XCL2 is being referred to also as lymphotactin-beta or lymphotactin 2
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |