VLSPADKTNVKAAWGKVGAHAGEYGAEALERMF |
VLVLDTDYK |
ITSN-1 |
||
This peptide corresponds to HbA(135-141), a bioactive fragment of hemoglobin-alpha. See: Neokyotorphin.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
For other entries pertaining to peptides that are usually not classified as cytokines or growth factors but that possess activities of cytokines see also: regulatory peptide factors.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |