VGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG |
VGRPEWWMDYQKRYG |
rearranged during transfection proto-oncogene |
||
for this putative neuropeptide see: Proenkephalin A(219-229).
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |