TNFAIP8L1 |
TNFAIP8L3 |
MSGRGKGGKVKGKAKSRSSRAGLQFPVGRIHRLLRKGNY |
||
(approved gene symbol) [TNFAIP8-like protein-2; TNFAIP8-like-2, tumor necrosis factor-alpha-induced protein 8-like-2; TNF-alpha-induced protein 8-like-2] The protein is related to TNFAIP8. Sun et al (2008) have used the abbreviation TIPE2 for this protein. A databank synonym is Inflammation factor protein 20. Choi et al (2010) have referred to the protein as Oxi-c [Oxidative stress regulated gene-c].
TNFAIP8L2 has been identified by Sun et al (2008) as a negative regulator of immune cell functions. Human
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |