RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC |
RTD-1a |
POF |
||
[Rhesus Theta-Defensin-1] This peptide has been found in granules of macaque monocytes and neutrophils (Tang et al, 1999). The peptide is synthesized by head-to-tail ligation of two nonapeptides related to alpha-Defensins and derived from two different alpha-Defensin precursors (termed Demidefensins by Tang et al, 1999). Demidefensin-1 is the same as RTD-1b [Rhesus Theta-Defensin-1b] and yields the peptide RCLCRRGVC
Demidefensin-2 is the same as RTD-1a [
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |