RL |
RL-388 |
type 2 activated macrophages |
||
RL-37 is an antimicrobial peptide identified in Rhesus monkey bone marrow (Zhao et al, 2001). The peptide (RLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS) belongs to the family of antimicrobial cathelicidins and resembles human LL-37. RL-37 rapidly permeabilizes the membranes of Escherichia coli ML-35p and lyses liposomes that simulate bacterial membranes. At NaCl concentrations similar to those of extracellular fluids, RL-37 is considerably more active than LL-37 against staphylococci.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |