RK-1 |
RK-13 |
stress platelets |
||
[rabbit kidney-2] RK-2 (KPYCSCKWRCGIGEEEKGICHKFPIVTYVCCRRP) is a protein identified in rabbit kidney. It is an endogenous antimicrobial peptide related to alpha-Defensins (Wu et al, 1998).
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |