OMVs |
Omwaprin-a |
cone photoreceptor cells |
||
also: Omwaprin-a, Oxywaprin, Oxywaprin-a. This cationic protein of 50 amino acids (KDRPKKPGLCPPRPQKPCVKECKNDDSCPGQQKCCNYGCKDECRDPIFVG) has been isolated from the venom of inland taipan (Oxyuranus microlepidotus). The protein is non-toxic to Swiss albino mice at doses of up to 10 mg/kg when administered intraperitoneally. It shows selective and dose-dependant antibacterial activity against Gram-positive bacteria. Omwaprin lacks haemolytic activity on human erythrocytes.
Some related proteins, termed omwaprin-b (Oxywaprin-b) with the sequence KDRPKKPGLCPPRPQKPCVKECKNDWSCPGQQKCCNYGCIDECRDPIFVN, and
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |