MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ |
MPSP |
Class III G-protein-coupled receptors |
||
[MPSCs]
[multipotential stem cells] see: hematopoiesis. See also: hematopoietic stem cells.
For other entries pertaining to hematopoiesis see also the Hematology Dictionary section of this encyclopedia. For related information of interest see also: Cell types Dictionary, Cell lines in Cytokine Research, Cell culture.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |