MME |
MMH |
Ang-(1-9) |
||
This peptide of 36 amino acids (MLWSASMRIFASAFSTRGLGTRMLMYCSLPSRCWRK) has been identified by functional screening of a marine metagenomic library. The peptide exhibits chitin binding, possesses direct cell-penetrating properties, and displays potent antifungal activity against Candida albicans and Aspergillus niger (Pushpanathan et al, 2012, 2012). MMGP1 causes cell death by binding with DNA and inhibition of transcription, followed by endogenous production of ROS.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |