COPE Media Kit


Cope Home
Previous entry:
MLKAHLIFSTPLTISLFDCATWRPYLQTEYYDVMTVISPPEFG
Next entry:
MLKLIFLHRLKRMRKRLKRKLRLWHRKRYK
Random entry:
REG1A
Search COPE:

MLKL

[Mixed lineage kinase domain-like; mixed lineage kinase domain like pseudokinase] MLKL, a kinase-dead kinase, has been identified as a critical critical component of the necrosome, a protein complex containing RIP1 and RIP3 that plays a role in programmed necrosis signaling (Sun et al, 2012; Wang et al, 2012). MLKL is phosphorylated by RIP3, and is critical for programmed necrosis. Necrosulfonamide specifically blocks necrosis downstream of RIP3 activation. Zhao et al. (2012) have reported that knock-down of MLKL expression confers resistance to programmed necrosis induced by TNF-alpha ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: April 2018



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=33982