MEGF5 |
MEGF10 |
GLWDTIKQAGKKFFLNVLDKIRCKVAGGCRT |
||
[multiple epidermal growth factor-like domains 7; Multiple EGF-like domains protein 7] This designation is based on the observation that the protein contains multiple protein domains resembling EGF-like domains. The protein is identical with EGFL7 [EGF-like-7] and hence VE-statin.
Note: in databanks, another protein, the unrelated LRP4, is also being referred to as MEGF7.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |