MCL1S |
MCMP |
Activity-regulated Inhibitor of Death genes |
||
[murine cathelin-like protein] The cDNA for MCLP has been isolated from murine bone marrow (Popsueva et al, 1996). The encoded protein (KGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ) is highly homologous to the pig cathelin, and to four neutrophil antimicrobial peptides: CAP-18, indolicidin, Bac5 and FALL39.
Secondary structure prediction studies have identified a highly cationic region in the C-terminal part of prepro-MCLP with a tendency to adopt an amphipathic alpha-helical conformation similar to that observed in many antimicrobial peptides. A synthetic peptide
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |